RPL23A Antibody

Images

 
Western Blot: RPL23A Antibody [NBP1-79918] - Jurkat Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL23A Antibody Summary

Immunogen
The immunogen for this antibody is RPL23A. Peptide sequence VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL23A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RPL23A and was validated on Western blot.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL23A Antibody

  • 60S ribosomal protein L23a
  • FLJ27455
  • MDA20
  • melanoma differentiation-associated gene 20
  • ribosomal protein L23a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NB100-93304
Species: Hu
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-47297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57600
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for RPL23A Antibody (NBP1-79918) (0)

There are no publications for RPL23A Antibody (NBP1-79918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL23A Antibody (NBP1-79918) (0)

There are no reviews for RPL23A Antibody (NBP1-79918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL23A Antibody (NBP1-79918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL23A Products

Bioinformatics Tool for RPL23A Antibody (NBP1-79918)

Discover related pathways, diseases and genes to RPL23A Antibody (NBP1-79918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL23A Antibody (NBP1-79918)

Discover more about diseases related to RPL23A Antibody (NBP1-79918).
 

Pathways for RPL23A Antibody (NBP1-79918)

View related products by pathway.

PTMs for RPL23A Antibody (NBP1-79918)

Learn more about PTMs related to RPL23A Antibody (NBP1-79918).

Blogs on RPL23A

There are no specific blogs for RPL23A, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL23A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL23A
Uniprot