RPL15 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of RPL15. Peptide sequence: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RPL15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for RPL15 Antibody - BSA Free
Background
RPL15, also known as Ribosomal Protein L15 or RPL10, has a 204 amino acid long isoform that is 24kDa, and a shorter 145 amino acid long isoform that is approximately 17kDa. RPL15 is a cytoplasmic protein that is component of the large 60S subunit of the ribosome. In some esophageal tumors, RPL15 has been found to be overexpressed. Current research on RPL14 has shown possible links with esophageal cancer, thyroid cancer, Diamond-Blackfan anemia and gastric cancer. RPL15 has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for RPL15 Antibody (NBP2-86782) (0)
There are no publications for RPL15 Antibody (NBP2-86782).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPL15 Antibody (NBP2-86782) (0)
There are no reviews for RPL15 Antibody (NBP2-86782).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPL15 Antibody (NBP2-86782) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPL15 Products
Blogs on RPL15