RPIP8 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RPIP8 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNDC3A.

  Source: E. coli

  Amino Acid Sequence: LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RUNDC3A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80855.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPIP8 Recombinant Protein Antigen

• Rap2-interacting protein 8
• RAP2IPRUN domain-containing protein 3A
• RPIP-8
• RPIP8RaP2 interacting protein 8
• RUN domain containing 3A

Background

RPIP8 is a gene that codes for a protein that has four isoforms, with lengths of 446, 400, 405, and 364 amino acids long and weights of approximately 50, 45, 46, and 41 kDa, respectively. RPIP8 functions as an effector of RAP2A in neuronal cells. Current research is being done on diseases and disorders relating to this gene including dementia, ataxia, malaria, and neuronitis. RPIP8 has also been shown to have interactions with RAP2B, GFI1B, EIF3E, AP2M1, and AP1M1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RUNDC3A