RPH3AL Recombinant Protein Antigen

Images

 
There are currently no images for RPH3AL Protein (NBP1-80991PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPH3AL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPH3AL.

Source: E.coli

Amino Acid Sequence: QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPH3AL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80991.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RPH3AL Recombinant Protein Antigen

  • Noc2
  • NOC2No C2 domains protein
  • rab effector Noc2
  • rabphilin 3A-like (without C2 domains)
  • Rabphilin-3A-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP2-45883
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-41205
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP, PLA
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33037
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57641
Species: Hu
Applications: WB, ICC/IF
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow

Publications for RPH3AL Protein (NBP1-80991PEP) (0)

There are no publications for RPH3AL Protein (NBP1-80991PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPH3AL Protein (NBP1-80991PEP) (0)

There are no reviews for RPH3AL Protein (NBP1-80991PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPH3AL Protein (NBP1-80991PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RPH3AL Products

Bioinformatics Tool for RPH3AL Protein (NBP1-80991PEP)

Discover related pathways, diseases and genes to RPH3AL Protein (NBP1-80991PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPH3AL Protein (NBP1-80991PEP)

Discover more about diseases related to RPH3AL Protein (NBP1-80991PEP).
 

Pathways for RPH3AL Protein (NBP1-80991PEP)

View related products by pathway.

PTMs for RPH3AL Protein (NBP1-80991PEP)

Learn more about PTMs related to RPH3AL Protein (NBP1-80991PEP).

Blogs on RPH3AL

There are no specific blogs for RPH3AL, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

RAB8A Antibody (3G1)
H00004218-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPH3AL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPH3AL
COVID-19 update