Recombinant Human RPA14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPA14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 12-121 of Human RPA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD

Protein/Peptide Type
Partial Recombinant Protein
Gene
RPA3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPA14 Protein

  • REPA3Replication factor A protein 3
  • replication protein A 14 kDa subunit
  • replication protein A3 (14kD)
  • replication protein A3, 14kDa
  • RF-A protein 3
  • RP-A p14
  • RPA14

Background

RPA3 - replication protein A3, 14kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
H00029935-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006119-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPA14 Partial Recombinant Protein (H00006119-Q01) (0)

There are no publications for RPA14 Partial Recombinant Protein (H00006119-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPA14 Partial Recombinant Protein (H00006119-Q01) (0)

There are no reviews for RPA14 Partial Recombinant Protein (H00006119-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPA14 Partial Recombinant Protein (H00006119-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPA14 Products

Bioinformatics Tool for RPA14 Partial Recombinant Protein (H00006119-Q01)

Discover related pathways, diseases and genes to RPA14 Partial Recombinant Protein (H00006119-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPA14 Partial Recombinant Protein (H00006119-Q01)

Discover more about diseases related to RPA14 Partial Recombinant Protein (H00006119-Q01).
 

Pathways for RPA14 Partial Recombinant Protein (H00006119-Q01)

View related products by pathway.

PTMs for RPA14 Partial Recombinant Protein (H00006119-Q01)

Learn more about PTMs related to RPA14 Partial Recombinant Protein (H00006119-Q01).
 

Research Areas for RPA14 Partial Recombinant Protein (H00006119-Q01)

Find related products by research area.

Blogs on RPA14

There are no specific blogs for RPA14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPA14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPA3