Recombinant Human RNPS1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RNPS1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 158-239 of Human RNPS1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNPS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNPS1 GST (N-Term) Protein

  • E5.1
  • LDC2
  • MGC117332
  • RNA binding protein S1, serine-rich domain
  • RNA-binding protein S1, serine-rich domain
  • RNA-binding protein with serine-rich domain 1
  • SR protein
  • SR-related protein LDC2

Background

RNPS1 - RNA binding protein S1, serine-rich domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92826
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NBP2-19807
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-04142
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-87194
Species: Hu
Applications: WB
NBP1-90179
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-93598
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010921-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RNPS1 Partial Recombinant Protein (H00010921-Q01) (0)

There are no publications for RNPS1 Partial Recombinant Protein (H00010921-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNPS1 Partial Recombinant Protein (H00010921-Q01) (0)

There are no reviews for RNPS1 Partial Recombinant Protein (H00010921-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNPS1 Partial Recombinant Protein (H00010921-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RNPS1 Products

Bioinformatics Tool for RNPS1 Partial Recombinant Protein (H00010921-Q01)

Discover related pathways, diseases and genes to RNPS1 Partial Recombinant Protein (H00010921-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNPS1 Partial Recombinant Protein (H00010921-Q01)

Discover more about diseases related to RNPS1 Partial Recombinant Protein (H00010921-Q01).
 

Pathways for RNPS1 Partial Recombinant Protein (H00010921-Q01)

View related products by pathway.

PTMs for RNPS1 Partial Recombinant Protein (H00010921-Q01)

Learn more about PTMs related to RNPS1 Partial Recombinant Protein (H00010921-Q01).
 

Research Areas for RNPS1 Partial Recombinant Protein (H00010921-Q01)

Find related products by research area.

Blogs on RNPS1

There are no specific blogs for RNPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNPS1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNPS1