RNF8 Antibody

Images

 
Western Blot: RNF8 Antibody [H00009025-B01P] - Analysis of RNF8 expression in transfected 293T cell line by RNF8 polyclonal antibody. Lane 1: RNF8 transfected lysate(53.35 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: RNF8 Antibody [H00009025-B01P] - Analysis of purified antibody to RNF8 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF8 Antibody Summary

Immunogen
RNF8 (NP_003949.1, 1 a.a. - 485 a.a.) full-length human protein. MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Specificity
Reacts with ring finger protein 8.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RNF8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in WB, IF and as a detection antibody in ELISA.
Publications
Read Publications using H00009025-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF8 Antibody

  • ActA Binding Protein 2
  • C3HC4-type zinc finger protein
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ12013
  • KIAA0646UBC13/UEV-interacting ring finger protein
  • ring finger protein (C3HC4 type) 8
  • ring finger protein 8E3 ubiquitin-protein ligase RNF8
  • RNF8

Background

The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
AF7217
Species: Hu, Mu
Applications: WB, ICC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56357
Species: Hu
Applications: WB, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for RNF8 Antibody (H00009025-B01P)(4)

Reviews for RNF8 Antibody (H00009025-B01P) (0)

There are no reviews for RNF8 Antibody (H00009025-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF8 Antibody (H00009025-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF8 Products

Bioinformatics Tool for RNF8 Antibody (H00009025-B01P)

Discover related pathways, diseases and genes to RNF8 Antibody (H00009025-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF8 Antibody (H00009025-B01P)

Discover more about diseases related to RNF8 Antibody (H00009025-B01P).
 

Pathways for RNF8 Antibody (H00009025-B01P)

View related products by pathway.

PTMs for RNF8 Antibody (H00009025-B01P)

Learn more about PTMs related to RNF8 Antibody (H00009025-B01P).
 

Research Areas for RNF8 Antibody (H00009025-B01P)

Find related products by research area.

Blogs on RNF8.

53BP1 - DNA damage is no fun
The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF8
Entrez
Uniprot