RNF8 Antibody

Western Blot: RNF8 Antibody [H00009025-B01P] - Analysis of RNF8 expression in transfected 293T cell line by RNF8 polyclonal antibody. Lane 1: RNF8 transfected lysate(53.35 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: RNF8 Antibody [H00009025-B01P] - Analysis of purified antibody to RNF8 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

RNF8 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RNF8 (NP_003949.1, 1 a.a. - 485 a.a.) full-length human protein. MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
• Specificity: Reacts with ring finger protein 8.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RNF8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB, IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF8 Antibody

• ActA Binding Protein 2
• C3HC4-type zinc finger protein
• EC 6.3.2
• EC 6.3.2.-
• FLJ12013
• KIAA0646UBC13/UEV-interacting ring finger protein
• ring finger protein (C3HC4 type) 8
• ring finger protein 8E3 ubiquitin-protein ligase RNF8
• RNF8

Background

The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF8 Antibody (H00009025-B01P)(4)

Publications using H00009025-B01P

• Hodge CD, Ismail IH, Edwards RA et al. RNF8 E3 Ubiquitin Ligase Stimulates Ubc13 E2 Conjugating Activity That Is Essential for DNA Double Strand Break Signaling and BRCA1 Tumor Suppressor Recruitment. J Biol Chem 2016-04-29 [PMID: 26903517]
• Yang J, Deng W, Hau PM et al. Epstein-Barr virus BZLF1 protein impairs accumulation of host DNA damage proteins at damage sites in response to DNA damage. Lab Invest. 2015-06-01 [PMID: 26006018]
• Hau PM, Deng W, Jia L et al. Role of ATM in the Formation of Replication Compartment During Lytic Replication of EBV in Nasopharyngeal Epithelial Cells. J Virol. 2014-10-29 [PMID: 25355892]
• Morris JR, Boutell C, Keppler M et al. The SUMO modification pathway is involved in the BRCA1 response to genotoxic stress. Nature 2009-12-01 [PMID: 20016594]

Bioinformatics

• Gene Symbol: RNF8
• Entrez:
  • 9025(Human)
• Uniprot:
  • NP_003949.1(Human)