RNF25 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RNF25 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF25.
  
  

  Source: E. coli

  Amino Acid Sequence: CFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RNF25
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89069.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNF25 Recombinant Protein Antigen

• AO7
• EC 6.3.2.-
• FLJ13906
• ring finger protein 25E3 ubiquitin-protein ligase RNF25
• ring finger protein AO7

Background

RING finger protein 25 (RNF25, also named AO7) contains a RING finger domain and is ubiquitously expressed in various tissues. RNF25 was initially identified in a yeast two-hybrid screen of a murine T-cell library by using UbcH5b, an E2 enzyme, as bait. RNF25 has also been shown to act as a putative E3 ligase, at least in vitro. RNF25 localizes predominantly in the nucleus and supports the transcriptional activity of NF-kB by interacting with p65 in vivo upon stimulation with TNF. Yeast two-hybrid data also suggest that RNF25 interacts with a number of other molecules which may be potential ubiquitin ligase substrates. Among these are molecules that have critical roles in signal transduction and in regulation of translation (personal communication, Allan Weissman, CCR-NCI, Bethesda, MD).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RNF25