Novus Biologicals products are now on bio-techne.com

RNF17 Antibody (1E3)

Images

 
Sandwich ELISA: RNF17 Antibody (1E3) [H00056163-M01] - Detection limit for recombinant GST tagged RNF17 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF17 Antibody (1E3) Summary

Immunogen
RNF17 (NP_112567, 30 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSASTDKTLLNSS
Specificity
RNF17 - ring finger protein 17
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF17
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF17 Antibody (1E3)

  • FLJ11045
  • Mmip-2
  • ring finger protein 17
  • SPATA23
  • spermatogenesis associated 23
  • TDRD4
  • tudor domain containing 4
  • Tudor domain-containing protein 4

Background

This gene is similar to a mouse gene that encodes a testis-specific protein containing a RING finger domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-85249
Species: Hu, Mu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB6296
Species: Mu
Applications: IHC
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
AF6286
Species: Hu
Applications: IHC, WB
NBP2-24590
Species: Mu
Applications: IHC, IHC-P, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP2-90153
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NBP2-37398
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP3-21396
Species: Hu
Applications: IHC, IHC-P
NBP1-56937
Species: Hu
Applications: WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-81971
Species: Hu
Applications: IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
NB100-137
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
AF4185
Species: Hu
Applications: ICC

Publications for RNF17 Antibody (H00056163-M01) (0)

There are no publications for RNF17 Antibody (H00056163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF17 Antibody (H00056163-M01) (0)

There are no reviews for RNF17 Antibody (H00056163-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF17 Antibody (H00056163-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF17 Antibody (1E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF17
Entrez
OMIM
Uniprot