RNF13 Antibody

Images

 
Western Blot: RNF13 Antibody [NBP2-57493] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RNF13 Antibody [NBP2-57493] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RNF13 Antibody [NBP2-57493] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC
Specificity
Specificity of human RNF13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF13 Recombinant Protein Antigen (NBP2-57493PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNF13 Antibody

  • EC 6.3.2.-
  • FLJ93817
  • MGC13689
  • ring finger protein 13E3 ubiquitin-protein ligase RNF13
  • RZFRING zinc finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-40730
Species: Hu
Applications: WB, IHC, IHC-P
MAB829
Species: Hu
Applications: WB, IHC
NBP2-45816
Species: Hu
Applications: WB, Flow, IHC
H00010781-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NB100-56548
Species: Hu
Applications: WB, ICC/IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RNF13 Antibody (NBP2-57493) (0)

There are no publications for RNF13 Antibody (NBP2-57493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF13 Antibody (NBP2-57493) (0)

There are no reviews for RNF13 Antibody (NBP2-57493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF13 Antibody (NBP2-57493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF13 Products

Bioinformatics Tool for RNF13 Antibody (NBP2-57493)

Discover related pathways, diseases and genes to RNF13 Antibody (NBP2-57493). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF13 Antibody (NBP2-57493)

Discover more about diseases related to RNF13 Antibody (NBP2-57493).
 

Pathways for RNF13 Antibody (NBP2-57493)

View related products by pathway.

PTMs for RNF13 Antibody (NBP2-57493)

Learn more about PTMs related to RNF13 Antibody (NBP2-57493).
 

Research Areas for RNF13 Antibody (NBP2-57493)

Find related products by research area.

Blogs on RNF13

There are no specific blogs for RNF13, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF13