Recombinant Human RNF11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-154 of Human RNF11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RNF11

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF11 Protein

  • CGI-123
  • MGC51169
  • ring finger protein 11
  • RNF11
  • SID1669
  • Sid1669p

Background

RNF11( AAH20964, 1 a.a. - 155 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NB100-68142
Species: Hu
Applications: WB, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF482
Species: Mu
Applications: WB, IHC
AF5650
Species: Hu
Applications: WB, IHC
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-975
Species: Hu
Applications: WB
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6916
Species: Hu, Mu, Rt
Applications: WB
AF2958
Species: Hu
Applications: WB
H00026994-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RNF11 Recombinant Protein (H00026994-P01) (0)

There are no publications for RNF11 Recombinant Protein (H00026994-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF11 Recombinant Protein (H00026994-P01) (0)

There are no reviews for RNF11 Recombinant Protein (H00026994-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF11 Recombinant Protein (H00026994-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF11 Products

Bioinformatics Tool for RNF11 Recombinant Protein (H00026994-P01)

Discover related pathways, diseases and genes to RNF11 Recombinant Protein (H00026994-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF11 Recombinant Protein (H00026994-P01)

Discover more about diseases related to RNF11 Recombinant Protein (H00026994-P01).
 

Pathways for RNF11 Recombinant Protein (H00026994-P01)

View related products by pathway.

PTMs for RNF11 Recombinant Protein (H00026994-P01)

Learn more about PTMs related to RNF11 Recombinant Protein (H00026994-P01).
 

Research Areas for RNF11 Recombinant Protein (H00026994-P01)

Find related products by research area.

Blogs on RNF11

There are no specific blogs for RNF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RNF11 Antibody
NBP2-13235

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF11
Entrez