RNF11 Antibody (4G7)

Immunocytochemistry/Immunofluorescence: RNF11 Antibody (4G7) [H00026994-M01] - Analysis of monoclonal antibody to RNF11 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: RNF11 Antibody (4G7) [H00026994-M01] - Detection limit for recombinant GST tagged RNF11 is 0.1 ng/ml as a capture antibody.

Product Discontinued

RNF11 Antibody (4G7) Summary

• Immunogen: RNF11 (NP_055187, 65 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
• Specificity: RNF11 (4G7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF11 Antibody (4G7)

• CGI-123
• MGC51169
• ring finger protein 11
• RNF11
• SID1669
• Sid1669p

Background

The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF11 Antibody (H00026994-M01)(1)

Publication using H00026994-M01

• Martin G, Gruber AR, Keller W, Zavolan M. Genome-wide Analysis of Pre-mRNA 3 End Processing Reveals a Decisive Role of Human Cleavage Factor I in the Regulation of 3 UTR Length. Cell Rep. 2012-06-28 [PMID: 22813749]

Bioinformatics

• Gene Symbol: RNF11
• Entrez:
  • 26994(Human)
• Uniprot:
  • NP_055187()