Recombinant Human RLF Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RLF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1805-1913 of Human RLF

Source: Wheat Germ

Amino Acid Sequence: SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RLF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RLF Protein

  • MGC142226
  • Rearranged L-myc fusion gene protein
  • rearranged L-myc fusion sequence
  • rearranged L-myc fusion
  • zinc finger protein Rlf
  • Zn-15 related
  • Zn-15L
  • Zn-15-related protein
  • ZNF292L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56832
Species: Hu, Mu, Rt, Bv, Ca, GP
Applications: WB
NLS4753
Species: Hu, Mu, Rt, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45572
Species: Hu
Applications: WB, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-52823
Species: Hu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
MAB8898
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no publications for RLF Partial Recombinant Protein (H00006018-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no reviews for RLF Partial Recombinant Protein (H00006018-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RLF Products

Array H00006018-Q01

Bioinformatics Tool for RLF Partial Recombinant Protein (H00006018-Q01)

Discover related pathways, diseases and genes to RLF Partial Recombinant Protein (H00006018-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RLF Partial Recombinant Protein (H00006018-Q01)

Discover more about diseases related to RLF Partial Recombinant Protein (H00006018-Q01).
 

Pathways for RLF Partial Recombinant Protein (H00006018-Q01)

View related products by pathway.

PTMs for RLF Partial Recombinant Protein (H00006018-Q01)

Learn more about PTMs related to RLF Partial Recombinant Protein (H00006018-Q01).

Blogs on RLF

There are no specific blogs for RLF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RLF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RLF