Recombinant Human RLF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RLF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1805-1913 of Human RLF partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RLF
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RLF Protein

  • MGC142226
  • Rearranged L-myc fusion gene protein
  • rearranged L-myc fusion sequence
  • rearranged L-myc fusion
  • zinc finger protein Rlf
  • Zn-15 related
  • Zn-15L
  • Zn-15-related protein
  • ZNF292L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005863-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
H00059350-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006018-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no publications for RLF Partial Recombinant Protein (H00006018-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no reviews for RLF Partial Recombinant Protein (H00006018-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RLF Partial Recombinant Protein (H00006018-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RLF Products

Bioinformatics Tool for RLF Partial Recombinant Protein (H00006018-Q01)

Discover related pathways, diseases and genes to RLF Partial Recombinant Protein (H00006018-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RLF Partial Recombinant Protein (H00006018-Q01)

Discover more about diseases related to RLF Partial Recombinant Protein (H00006018-Q01).
 

Pathways for RLF Partial Recombinant Protein (H00006018-Q01)

View related products by pathway.

PTMs for RLF Partial Recombinant Protein (H00006018-Q01)

Learn more about PTMs related to RLF Partial Recombinant Protein (H00006018-Q01).

Blogs on RLF

There are no specific blogs for RLF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RLF Antibody
NBP1-33086

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RLF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RLF