RIZ1 Recombinant Protein Antigen

Images

 
There are currently no images for RIZ1 Protein (NBP1-89644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RIZ1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRDM2.

Source: E. coli

Amino Acid Sequence: PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RIZ1 Recombinant Protein Antigen

  • EC 2.1.1.43
  • GATA-3 binding protein G3B
  • GATA-3-binding protein G3B
  • KMT8PR domain-containing protein 2
  • Lysine N-methyltransferase 8
  • MTB-ZFHUMHOXY1
  • PR domain containing 2, with ZNF domain
  • PR domain zinc finger protein 2
  • retinoblastoma protein-binding zinc finger protein
  • Retinoblastoma protein-interacting zinc finger protein
  • RIZ1
  • RIZ2
  • RIZMTE-binding protein
  • Zinc finger protein RIZ
  • zinc-finger DNA-binding protein

Background

RIZ1 (Retinoblastoma proteininteracting zinc finger), also known as PRDM2, is a nuclear protein containing 8 zinc finger motifs. RIZ1 contains a PR domain that may function as protein binding interface in the regulation of chromatin-mediated gene expression. RIZ 1 acts as a tumor suppressor, and RIZ 1 inactivation is common in many types of human cancers, including neuroendocrine, breast, liver, colon, skin, and lymphoid tumors. Similarly, RIZ1 over-expression in breast cancer cells caused cell cycle arrest in G2-M and apoptosis. RIZ1 is highly expressed in human retinoblastoma cells and at low levels in all other human cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
352-MS
Species: Hu
Applications: BA
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
AF4885
Species: Mu
Applications: IP, WB

Publications for RIZ1 Protein (NBP1-89644PEP) (0)

There are no publications for RIZ1 Protein (NBP1-89644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIZ1 Protein (NBP1-89644PEP) (0)

There are no reviews for RIZ1 Protein (NBP1-89644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RIZ1 Protein (NBP1-89644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIZ1 Products

Array NBP1-89644PEP

Research Areas for RIZ1 Protein (NBP1-89644PEP)

Find related products by research area.

Blogs on RIZ1

There are no specific blogs for RIZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RIZ1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM2