RIZ1 Recombinant Protein Antigen

Images

 
There are currently no images for RIZ1 Protein (NBP1-89644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RIZ1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRDM2.

Source: E.coli

Amino Acid Sequence: PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89644.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RIZ1 Recombinant Protein Antigen

  • EC 2.1.1.43
  • GATA-3 binding protein G3B
  • GATA-3-binding protein G3B
  • KMT8PR domain-containing protein 2
  • Lysine N-methyltransferase 8
  • MTB-ZFHUMHOXY1
  • PR domain containing 2, with ZNF domain
  • PR domain zinc finger protein 2
  • retinoblastoma protein-binding zinc finger protein
  • Retinoblastoma protein-interacting zinc finger protein
  • RIZ1
  • RIZ2
  • RIZMTE-binding protein
  • Zinc finger protein RIZ
  • zinc-finger DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
MAB6798
Species: Hu
Applications: WB, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RIZ1 Protein (NBP1-89644PEP) (0)

There are no publications for RIZ1 Protein (NBP1-89644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIZ1 Protein (NBP1-89644PEP) (0)

There are no reviews for RIZ1 Protein (NBP1-89644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RIZ1 Protein (NBP1-89644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-89644PEP

Bioinformatics Tool for RIZ1 Protein (NBP1-89644PEP)

Discover related pathways, diseases and genes to RIZ1 Protein (NBP1-89644PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIZ1 Protein (NBP1-89644PEP)

Discover more about diseases related to RIZ1 Protein (NBP1-89644PEP).
 

Pathways for RIZ1 Protein (NBP1-89644PEP)

View related products by pathway.

PTMs for RIZ1 Protein (NBP1-89644PEP)

Learn more about PTMs related to RIZ1 Protein (NBP1-89644PEP).
 

Research Areas for RIZ1 Protein (NBP1-89644PEP)

Find related products by research area.

Blogs on RIZ1

There are no specific blogs for RIZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RIZ1 Antibody
NBP1-89644
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RIZ1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM2