RIPX Antibody - BSA Free

Western Blot: RIPX Antibody [NBP3-35284] - Western blot analysis of various lysates using RIPX Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RIPX Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RIPX (NP_055776.1).
  
  Sequence:
  MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUFY3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RIPX Antibody - BSA Free

• KIAA0871SINGAR1
• protein RUFY3
• rap2 interacting protein x
• Rap2-interacting protein x
• RIPX
• RUN and FYVE domain containing 3
• singar
• Singar1
• Single axon-regulated protein
• single axon-related 1

Background

Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RUFY3