RUFY2 Antibody

Images

 
Western Blot: RUFY2 Antibody [NBP1-90448] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RUFY2 Antibody [NBP1-90448] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RUFY2 Antibody [NBP1-90448] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUFY2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUFY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUFY2 Protein (NBP1-90448PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUFY2 Antibody

  • antigen MU-RMS-40.17
  • FLJ10063
  • KIAA1537
  • rab4-interacting protein related
  • RABIP4R
  • RUN and FYVE domain containing 2
  • RUN and FYVE domain-containing 2
  • RUN and FYVE domain-containing protein 2
  • Run- and FYVE-domain containing protein
  • ZFYVE13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83606
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5887
Species: Hu
Applications: WB, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93639
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
H00058508-R04
Species: Hu
640-A3
Species: Mu
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1440
Species: Mu
Applications: WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90448
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RUFY2 Antibody (NBP1-90448) (0)

There are no publications for RUFY2 Antibody (NBP1-90448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUFY2 Antibody (NBP1-90448) (0)

There are no reviews for RUFY2 Antibody (NBP1-90448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUFY2 Antibody (NBP1-90448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUFY2 Products

RUFY2 NBP1-90448

Bioinformatics Tool for RUFY2 Antibody (NBP1-90448)

Discover related pathways, diseases and genes to RUFY2 Antibody (NBP1-90448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUFY2 Antibody (NBP1-90448)

Discover more about diseases related to RUFY2 Antibody (NBP1-90448).
 

Pathways for RUFY2 Antibody (NBP1-90448)

View related products by pathway.

PTMs for RUFY2 Antibody (NBP1-90448)

Learn more about PTMs related to RUFY2 Antibody (NBP1-90448).

Blogs on RUFY2

There are no specific blogs for RUFY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUFY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUFY2