![Western Blot: RIPX Antibody [NBP2-48558] - Analysis: NBP2-48558 (A) shows similar pattern to independent antibody NBP1-89614 (B)](http://images.novusbio.com/fullsize/RIPX-Antibody-Western-Blot-NBP2-48558-img0007.jpg "Western Blot: RIPX Antibody [NBP2-48558] - Analysis: NBP2-48558 (A) shows similar pattern to independent antibody NBP1-89614 (B)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RUFY3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RUFY3 |
![Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining in human cerebral cortex and pancreas tissues using anti-RUFY3 antibody. Corresponding RUFY3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RIPX-Antibody-Immunohistochemistry-Paraffin-NBP2-48558-img0006.jpg "Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining in human cerebral cortex and pancreas tissues using anti-RUFY3 antibody. Corresponding RUFY3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/RIPX-Antibody-Immunohistochemistry-Paraffin-NBP2-48558-img0004.jpg "Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/RIPX-Antibody-Immunohistochemistry-Paraffin-NBP2-48558-img0005.jpg "Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human pancreas shows low expression as expected.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")