RIPX Antibody - BSA Free

Western Blot: RIPX Antibody [NBP2-48558] - Analysis: NBP2-48558 (A) shows similar pattern to independent antibody NBP1-89614 (B)

Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining in human cerebral cortex and pancreas tissues using anti-RUFY3 antibody. Corresponding RUFY3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: RIPX Antibody [NBP2-48558] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RIPX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RIPX Antibody - BSA Free (NBP2-48558) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUFY3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RIPX Recombinant Protein Antigen (NBP2-48558PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RIPX Antibody - BSA Free

• KIAA0871SINGAR1
• protein RUFY3
• rap2 interacting protein x
• Rap2-interacting protein x
• RIPX
• RUN and FYVE domain containing 3
• singar
• Singar1
• Single axon-regulated protein
• single axon-related 1

Background

Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RUFY3