RIOK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIOK2 Antibody [NBP1-83773] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: RIOK2 Antibody [NBP1-83773] - Staining of human pancreas shows strong cytoplasmic positivity in Islet cells and exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIOK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYRSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIOK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIOK2 Protein (NBP1-83773PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIOK2 Antibody

  • EC 2.7.11.1
  • FLJ11159
  • RIO kinase 2 (yeast)
  • RIO kinase 2
  • RIO2
  • serine/threonine-protein kinase RIO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13663
Species: Hu
Applications: IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86734
Species: Hu
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-84619
Species: Hu
Applications: WB, IHC, IHC-P
H00056902-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58953
Species: Hu
Applications: ICC/IF
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-31598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83773
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RIOK2 Antibody (NBP1-83773) (0)

There are no publications for RIOK2 Antibody (NBP1-83773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIOK2 Antibody (NBP1-83773) (0)

There are no reviews for RIOK2 Antibody (NBP1-83773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIOK2 Antibody (NBP1-83773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIOK2 Products

Bioinformatics Tool for RIOK2 Antibody (NBP1-83773)

Discover related pathways, diseases and genes to RIOK2 Antibody (NBP1-83773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RIOK2 Antibody (NBP1-83773)

View related products by pathway.

Research Areas for RIOK2 Antibody (NBP1-83773)

Find related products by research area.

Blogs on RIOK2

There are no specific blogs for RIOK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIOK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIOK2