Recombinant Human RIN3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RIN3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 328-426 of Human RIN3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GPPDHPNQPPMMTCERLPCPTAGLGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSDGPEDTP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RIN3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RIN3 Protein

  • DKFZp762H1613
  • FLJ11700
  • FLJ22439
  • RAB5 interacting protein 3
  • Ras and Rab interactor 3
  • Ras interaction/interference protein 3

Background

RIN3 - Ras and Rab interactor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03062
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
MAB7824
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1477
Species: Mu
Applications: WB, IHC, Block
NBP1-91247
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RIN3 Partial Recombinant Protein (H00079890-Q01) (0)

There are no publications for RIN3 Partial Recombinant Protein (H00079890-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIN3 Partial Recombinant Protein (H00079890-Q01) (0)

There are no reviews for RIN3 Partial Recombinant Protein (H00079890-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIN3 Partial Recombinant Protein (H00079890-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIN3 Products

Bioinformatics Tool for RIN3 Partial Recombinant Protein (H00079890-Q01)

Discover related pathways, diseases and genes to RIN3 Partial Recombinant Protein (H00079890-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIN3 Partial Recombinant Protein (H00079890-Q01)

Discover more about diseases related to RIN3 Partial Recombinant Protein (H00079890-Q01).
 

Pathways for RIN3 Partial Recombinant Protein (H00079890-Q01)

View related products by pathway.

PTMs for RIN3 Partial Recombinant Protein (H00079890-Q01)

Learn more about PTMs related to RIN3 Partial Recombinant Protein (H00079890-Q01).
 

Research Areas for RIN3 Partial Recombinant Protein (H00079890-Q01)

Find related products by research area.

Blogs on RIN3

There are no specific blogs for RIN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

M-CSF
416-ML-010/CF
RIN3 Antibody
NBP1-83603

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RIN3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIN3