Rictor Antibody (1F3)

Images

 
Western Blot: Rictor Antibody (1F3) [H00253260-M01] - RICTOR monoclonal antibody (M01), clone 1F3 Analysis of RICTOR expression in Hela S3 NE.
Immunohistochemistry-Paraffin: Rictor Antibody (1F3) [H00253260-M01] - Analysis of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: Rictor Antibody (1F3) [H00253260-M01] - Analysis of RICTOR expression in transfected 293T cell line by RICTOR monoclonal antibody (M01), clone 1F3.Lane 1: RICTOR transfected lysate(29.8 KDa).Lane 2: ...read more
Immunoprecipitation: Rictor Antibody (1F3) [H00253260-M01] - Analysis of RICTOR transfected lysate using anti-RICTOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RICTOR MaxPab rabbit ...read more
Sandwich ELISA: Rictor Antibody (1F3) [H00253260-M01] - Detection limit for recombinant GST tagged RICTOR is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, IP, PLA, S-ELISA
Clone
1F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rictor Antibody (1F3) Summary

Immunogen
RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Specificity
RICTOR - rapamycin-insensitive companion of mTOR
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RICTOR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00253260-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rictor Antibody (1F3)

  • AVO3 homolog
  • AVO3
  • hAVO3
  • KIAA1999DKFZp686B11164
  • mAVO3
  • MGC39830
  • PIA
  • Pianissimo
  • rapamycin-insensitive companion of mTOR
  • Rictor
  • RPTOR independent companion of MTOR, complex 2
  • TORC2-specific protein AVO3

Background

RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-89142
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB110-40424
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4004
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00253260-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, PLA, S-ELISA

Publications for Rictor Antibody (H00253260-M01)(5)

Reviews for Rictor Antibody (H00253260-M01) (0)

There are no reviews for Rictor Antibody (H00253260-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rictor Antibody (H00253260-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rictor Products

Bioinformatics Tool for Rictor Antibody (H00253260-M01)

Discover related pathways, diseases and genes to Rictor Antibody (H00253260-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rictor Antibody (H00253260-M01)

Discover more about diseases related to Rictor Antibody (H00253260-M01).
 

Pathways for Rictor Antibody (H00253260-M01)

View related products by pathway.

PTMs for Rictor Antibody (H00253260-M01)

Learn more about PTMs related to Rictor Antibody (H00253260-M01).
 

Research Areas for Rictor Antibody (H00253260-M01)

Find related products by research area.

Blogs on Rictor.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rictor Antibody (1F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RICTOR
Entrez
OMIM
Uniprot