Recombinant Human RICS Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RICS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-322 of Human RICS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLLPHFSARTELIVPFPLRLLRKQFTPPLLGPMSPLNPLVQITVCISI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARHGAP32
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RICS Protein

  • brain-specific Rho GTP-ase-activating protein
  • Brain-specific Rho GTPase-activating protein
  • GAB-associated CDC42
  • GAB-associated Cdc42/Rac GTPase-activating protein
  • GC-GAPGTPase regulator interacting with TrkA
  • GRITp200RhoGAP
  • KIAA0712p250GAP
  • MGC1892
  • rac GTPase activating protein
  • Rho GTPase activating protein 32
  • rho GTPase-activating protein 32
  • Rho/Cdc42/Rac GTPase-activating protein RICS
  • RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling
  • RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling
  • Rho-type GTPase-activating protein 32
  • RICSPX-RICS

Background

RICS( AAH00277, 1 a.a. - 323 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24696
Species: Hu
Applications: IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-76279
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
NBP1-83864
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P

Publications for RICS Recombinant Protein (H00009743-P01) (0)

There are no publications for RICS Recombinant Protein (H00009743-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RICS Recombinant Protein (H00009743-P01) (0)

There are no reviews for RICS Recombinant Protein (H00009743-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RICS Recombinant Protein (H00009743-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RICS Products

RICS H00009743-P01

Bioinformatics Tool for RICS Recombinant Protein (H00009743-P01)

Discover related pathways, diseases and genes to RICS Recombinant Protein (H00009743-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RICS

There are no specific blogs for RICS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RICS Antibody
NBP1-92334
RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RICS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP32