RHOXF2 Antibody

Images

 
Western Blot: RHOXF2 Antibody [NBP1-84364] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: RHOXF2 Antibody [NBP1-84364] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHOXF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOXF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHOXF2 Protein (NBP1-84364PEP)
Publications
Read Publication using NBP1-84364.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24944581)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHOXF2 Antibody

  • CT107
  • Paired-like homeobox protein PEPP-2
  • PEPP subfamily gene 2
  • PEPP-2
  • PEPP2cancer/testis antigen 107
  • rhox homeobox family member 2
  • Rhox homeobox family, member 2
  • Testis homeobox gene 1
  • THG1homeobox protein from AL590526

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00158800-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23727
Species: Hu, Rt
Applications: IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-47331
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
MAB6798
Species: Hu
Applications: WB, ICC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84363
Species: Hu
Applications: IHC, IHC-P
AF1005
Species: Hu
Applications: WB, IHC

Publications for RHOXF2 Antibody (NBP1-84364)(1)


Reviews for RHOXF2 Antibody (NBP1-84364) (0)

There are no reviews for RHOXF2 Antibody (NBP1-84364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHOXF2 Antibody (NBP1-84364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHOXF2 Products

Bioinformatics Tool for RHOXF2 Antibody (NBP1-84364)

Discover related pathways, diseases and genes to RHOXF2 Antibody (NBP1-84364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOXF2 Antibody (NBP1-84364)

Discover more about diseases related to RHOXF2 Antibody (NBP1-84364).
 

Pathways for RHOXF2 Antibody (NBP1-84364)

View related products by pathway.

PTMs for RHOXF2 Antibody (NBP1-84364)

Learn more about PTMs related to RHOXF2 Antibody (NBP1-84364).

Blogs on RHOXF2

There are no specific blogs for RHOXF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHOXF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOXF2