OTOA Antibody

Images

 
Immunohistochemistry-Paraffin: OTOA Antibody [NBP1-84363] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTOA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCMEEDTFIRTVELLGAVQGFSRPQLMTLKEKAIQVWDMPSYWREHHIVSLGRIALALNESELEQLDLSSIDTVASLSWQTEWTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OTOA Protein (NBP1-84363PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTOA Antibody

  • cancer/testis antigen 108
  • CT108
  • deafness, autosomal recessive 22
  • DFNB22
  • FLJ32773
  • MGC157747
  • MGC39813
  • otoancorin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84261
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-56991
Species: Hu
Applications: WB
H00084528-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
38160002
Species: Hu
Applications: WB, ELISA
H00051168-Q01
Species: Hu
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-75015
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30662
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA

Publications for OTOA Antibody (NBP1-84363) (0)

There are no publications for OTOA Antibody (NBP1-84363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTOA Antibody (NBP1-84363) (0)

There are no reviews for OTOA Antibody (NBP1-84363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OTOA Antibody (NBP1-84363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTOA Products

Bioinformatics Tool for OTOA Antibody (NBP1-84363)

Discover related pathways, diseases and genes to OTOA Antibody (NBP1-84363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTOA Antibody (NBP1-84363)

Discover more about diseases related to OTOA Antibody (NBP1-84363).

PTMs for OTOA Antibody (NBP1-84363)

Learn more about PTMs related to OTOA Antibody (NBP1-84363).

Blogs on OTOA

There are no specific blogs for OTOA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTOA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOA