Rhot1 Antibody (4H4)

Images

 
Western Blot: Rhot1 Antibody (4H4) [H00055288-M01] - Parkin knockout improves the decline of mitochondrial dynamics proteins in SOD1-G93A spinal cord, but mitochondrial protein ubiquitination profiles and March5 and ...read more
Western Blot: Rhot1 Antibody (4H4) [H00055288-M01] - RHOT1 monoclonal antibody (M01), clone 4H4 Analysis of RHOT1 expression in Hela S3 NE.
ELISA: Rhot1 Antibody (4H4) [H00055288-M01] - Detection limit for recombinant GST tagged RHOT1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rhot1 Antibody (4H4) Summary

Immunogen
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Specificity
RHOT1 - ras homolog gene family, member T1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RHOT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Publications
Read Publications using
H00055288-M01 in the following applications:

  • WB
    3 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30126943). Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rhot1 Antibody (4H4)

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88982
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-90182
Species: Hu
Applications: IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
NBP1-56761
Species: Hu
Applications: WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-52553
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-89112
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB

Publications for Rhot1 Antibody (H00055288-M01)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00055288-M01 Applications Species
Palomo GM, Granatiero V, Kawamata H et al. Parkin is a disease modifier in the mutant SOD1 mouse model of ALS EMBO Mol Med Aug 20 2018 [PMID: 30126943] (WB, Mouse) WB Mouse
Wang L, Gao J, Liu J et al. Mitofusin 2 Regulates Axonal Transport of Calpastatin to Prevent Neuromuscular Synaptic Elimination in Skeletal Muscles. Cell Metab. Jul 2 2018 [PMID: 30017354] (WB, Mouse) WB Mouse
Greiner GF, Conraux C, Collard M, Picart P. [Value of pendular rotational methods in the study of vestibular reequilibration]. Rev Otoneuroophtalmol 2018 [PMID: 29290944] (WB, Human) WB Human
Lee CA, Chin LS, Li L. et al. Hypertonia-linked protein Trak1 functions with mitofusins to promote mitochondrial tethering and fusion. Protein Cell Sep 18 2017 [PMID: 28924745]
Su B, Ji YS, Sun XL et al. Brain-Derived Neurotrophic Factor (BDNF)-Induced Mitochondrial Motility Arrest and Presynaptic Docking Contribute to BDNF-Enhanced Synaptic Transmission. J Biol Chem. 2013 Dec 03 [PMID: 24302729]
Chen XL, Serrano D, Mayhue M et al. GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T lymphocytes by promoting mitochondrial calcium accumulation. Biochem J. 2012 Oct 26 [PMID: 23098229]
Pozo KB, Stephenson FA. N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex. Biochim Biophys Acta 1813(1):269-81. 2011 Jan. [PMID: 21034780]
Macaskill AF, Brickley K, Stephenson FA et al. GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons. Mol Cell Neurosci 40(3):301-12. 2009 Mar. [PMID: 19103291]

Reviews for Rhot1 Antibody (H00055288-M01) (0)

There are no reviews for Rhot1 Antibody (H00055288-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rhot1 Antibody (H00055288-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rhot1 Products

Bioinformatics Tool for Rhot1 Antibody (H00055288-M01)

Discover related pathways, diseases and genes to Rhot1 Antibody (H00055288-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (H00055288-M01)

Discover more about diseases related to Rhot1 Antibody (H00055288-M01).
 

Pathways for Rhot1 Antibody (H00055288-M01)

View related products by pathway.

PTMs for Rhot1 Antibody (H00055288-M01)

Learn more about PTMs related to Rhot1 Antibody (H00055288-M01).
 

Research Areas for Rhot1 Antibody (H00055288-M01)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rhot1 Antibody (4H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOT1
Entrez
Uniprot