RHOBTB2 Antibody - BSA Free

Western Blot: RHOBTB2 Antibody [NBP3-35841] - Western blot analysis of lysates from Rat lung, using RHOBTB2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RHOBTB2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 320-480 of human RHOBTB2 (NP_001153508.1).
  
  Sequence:
  MDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOBTB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RHOBTB2 Antibody - BSA Free

• DBC2KIAA0717Deleted in breast cancer 2 gene protein
• p83
• Rho-related BTB domain containing 2
• rho-related BTB domain-containing protein 2

Background

RHOBTB2 (Rho-Related BTB Domain Containing 2) is a tumor suppressor for some forms of breast cancer and may have a role in protein transport. RHOBTB2 is known to have interactions with KDM5B, ARHGAP35, RAC2, RHOB and RHOBTB1. RHOBTB2 has been studied in relation to breast cancer, sporadic breast cancer, familial breast cancer and gastric cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHOBTB2