RHCG Antibody (5A4) - Azide and BSA Free

Western Blot: RHCG Antibody (5A4) [H00051458-M06] - Analysis of RHCG expression in PC-12 (Cat # L012V1).

Immunohistochemistry-Paraffin: RHCG Antibody (5A4) [H00051458-M06] - Analysis of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RHCG Antibody (5A4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RHCG Antibody (5A4) - Azide and BSA Free (H00051458-M06) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-RHCG Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
• Specificity: RHCG - Rhesus blood group, C glycoprotein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RHCG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RHCG Antibody (5A4) - Azide and BSA Free

• ammonium transporter Rh type C
• CDRC2
• chromosome 15 open reading frame 6
• PDRC2C15orf6
• Rh family type C glycoprotein
• Rh family, C glycoprotein
• Rh glycoprotein kidney
• Rh type C glycoprotein
• Rhesus blood group family type C glycoprotein
• Rhesus blood group, C glycoprotein
• RHGKTumor-related protein DRC2
• SLC42A3

Background

RHCG functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RHCG Antibody (H00051458-M06)(2)

Publications using H00051458-M06

• Chen P, Liu C, Li P et al. High RhCG expression predicts poor survival and promotes migration and proliferation of gastric cancer via keeping intracellular alkaline Exp. Cell Res. 2019-11-19 [PMID: 31756312]
• Hiatt MJ, Ivanova L, Toran N et al. Remodeling of the fetal collecting duct epithelium. Am J Pathol 176(2):630-7. 2010-02-01 [PMID: 20035053]

Bioinformatics

• Gene Symbol: RHCG
• Entrez:
  • 51458(Human)
• OMIM:
  • 605381(Human)
• Uniprot:
  • NP_057405(Human)