RHCE Antibody


Western Blot: RHCE Antibody [NBP1-69668] - This Anti-RHCE antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RHCE Antibody Summary

Synthetic peptides corresponding to RHCE(Rh blood group, CcEe antigens) The peptide sequence was selected from the N terminal of RHCE. Peptide sequence SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHCE and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHCE Antibody

  • blood group Rh(CE) polypeptide
  • blood group RhCcEe antigen
  • CD240CE antigen
  • CD240CE
  • MGC103977
  • Rh blood group antigen Evans
  • Rh blood group C antigen
  • Rh blood group, CcEe antigens
  • Rh polypeptide 1
  • Rh polypeptide I
  • RH
  • RH30A
  • Rh4
  • RHC
  • RHCE blood group variant Crawford antigen Rh43
  • RHE
  • Rhesus blood group CE protein
  • Rhesus blood group E antigen
  • Rhesus blood group Rhce antigen
  • Rhesus blood group, CcEe antigens
  • Rhesus C/E antigens
  • Rhesus system C and E polypeptides
  • RhIVb(J)
  • RHPI
  • RhVI
  • RhVIII
  • silenced Rh blood group CcEe antigen


The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Eq, GP, Rb
Applications: WB
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for RHCE Antibody (NBP1-69668) (0)

There are no publications for RHCE Antibody (NBP1-69668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHCE Antibody (NBP1-69668) (0)

There are no reviews for RHCE Antibody (NBP1-69668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHCE Antibody (NBP1-69668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RHCE Products

Array NBP1-69668

Bioinformatics Tool for RHCE Antibody (NBP1-69668)

Discover related pathways, diseases and genes to RHCE Antibody (NBP1-69668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHCE Antibody (NBP1-69668)

Discover more about diseases related to RHCE Antibody (NBP1-69668).

Pathways for RHCE Antibody (NBP1-69668)

View related products by pathway.

PTMs for RHCE Antibody (NBP1-69668)

Learn more about PTMs related to RHCE Antibody (NBP1-69668).

Blogs on RHCE

There are no specific blogs for RHCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RHCE Antibody and receive a gift card or discount.


Gene Symbol RHCE