RHBG Recombinant Protein Antigen

Images

 
There are currently no images for RHBG Recombinant Protein Antigen (NBP2-59022PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RHBG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to RHBG.

Source: E. coli

Amino Acid Sequence: ATHEAYGDGLESVFPLIAEGQRSATSQAMHQL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHBG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-59022 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RHBG Recombinant Protein Antigen

  • ammonium transporter Rh type B
  • Rh family type B glycoprotein
  • Rh family, B glycoprotein (gene/pseudogene)
  • Rh type B glycoprotein
  • Rhesus blood group family type B glycoprotein
  • Rhesus blood group, B glycoprotein
  • SLC42A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65887
Species: Hu
Applications: Flow, IP
NBP2-84247
Species: Hu
Applications: WB
NBP2-30905
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-72961
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB110-81529
Species: Hu, Mu, Rt, Po, Ma-Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, KD, KO
NBP2-38236
Species: Hu
Applications: WB, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-05549
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC
NBP2-59022PEP
Species: Hu
Applications: AC

Publications for RHBG Recombinant Protein Antigen (NBP2-59022PEP) (0)

There are no publications for RHBG Recombinant Protein Antigen (NBP2-59022PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBG Recombinant Protein Antigen (NBP2-59022PEP) (0)

There are no reviews for RHBG Recombinant Protein Antigen (NBP2-59022PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RHBG Recombinant Protein Antigen (NBP2-59022PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RHBG Products

Array NBP2-59022PEP

Bioinformatics Tool for RHBG Recombinant Protein Antigen (NBP2-59022PEP)

Discover related pathways, diseases and genes to RHBG Recombinant Protein Antigen (NBP2-59022PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBG Recombinant Protein Antigen (NBP2-59022PEP)

Discover more about diseases related to RHBG Recombinant Protein Antigen (NBP2-59022PEP).
 

Pathways for RHBG Recombinant Protein Antigen (NBP2-59022PEP)

View related products by pathway.

PTMs for RHBG Recombinant Protein Antigen (NBP2-59022PEP)

Learn more about PTMs related to RHBG Recombinant Protein Antigen (NBP2-59022PEP).

Blogs on RHBG

There are no specific blogs for RHBG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RHBG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBG