RHBG Antibody


Western Blot: RHBG Antibody [NBP1-69483] - This Anti-RHBG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: RHBG Antibody [NBP1-69483] - Staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. RHBG Antibody concentration 5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

RHBG Antibody Summary

Synthetic peptides corresponding to RHBG(Rh family, B glycoprotein) The peptide sequence was selected from the C terminal of RHBG. Peptide sequence LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RHBG and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHBG Antibody

  • ammonium transporter Rh type B
  • Rh family type B glycoprotein
  • Rh family, B glycoprotein (gene/pseudogene)
  • Rh type B glycoprotein
  • Rhesus blood group family type B glycoprotein
  • Rhesus blood group, B glycoprotein
  • SLC42A2


RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1309 AF193807.1 1-1309 1310-1310 AL139130.28 4265-4265 1311-1806 AF193807.1 1310-1805


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC

Publications for RHBG Antibody (NBP1-69483) (0)

There are no publications for RHBG Antibody (NBP1-69483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBG Antibody (NBP1-69483) (0)

There are no reviews for RHBG Antibody (NBP1-69483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBG Antibody (NBP1-69483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RHBG Products

Bioinformatics Tool for RHBG Antibody (NBP1-69483)

Discover related pathways, diseases and genes to RHBG Antibody (NBP1-69483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBG Antibody (NBP1-69483)

Discover more about diseases related to RHBG Antibody (NBP1-69483).

Pathways for RHBG Antibody (NBP1-69483)

View related products by pathway.

PTMs for RHBG Antibody (NBP1-69483)

Learn more about PTMs related to RHBG Antibody (NBP1-69483).

Blogs on RHBG

There are no specific blogs for RHBG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RHBG Antibody and receive a gift card or discount.


Gene Symbol RHBG