RGS18 Antibody


Immunocytochemistry/ Immunofluorescence: RGS18 Antibody [NBP2-76522] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

RGS18 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84)% and Rat (88)%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RGS18 Antibody

  • regulator of G-protein signaling 18
  • regulator of G-protein signalling 13
  • RGS13regulator of G-protein signalling 18


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA, KD
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Rt, Pm
Applications: IHC, IHC-P

Publications for RGS18 Antibody (NBP2-76522) (0)

There are no publications for RGS18 Antibody (NBP2-76522).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS18 Antibody (NBP2-76522) (0)

There are no reviews for RGS18 Antibody (NBP2-76522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGS18 Antibody (NBP2-76522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RGS18 Products

Bioinformatics Tool for RGS18 Antibody (NBP2-76522)

Discover related pathways, diseases and genes to RGS18 Antibody (NBP2-76522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS18 Antibody (NBP2-76522)

Discover more about diseases related to RGS18 Antibody (NBP2-76522).

Pathways for RGS18 Antibody (NBP2-76522)

View related products by pathway.

PTMs for RGS18 Antibody (NBP2-76522)

Learn more about PTMs related to RGS18 Antibody (NBP2-76522).

Research Areas for RGS18 Antibody (NBP2-76522)

Find related products by research area.

Blogs on RGS18

There are no specific blogs for RGS18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RGS18 Antibody and receive a gift card or discount.


Gene Symbol RGS18