RGS3 Antibody (1E8-C7)

Images

 
Western Blot: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of RGS3 expression in transfected 293T cell line by RGS3 monoclonal antibody (M01), clone 1E8-C7.Lane 1: RGS3 transfected lysate(19.5 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of monoclonal antibody to RGS3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of monoclonal antibody to RGS3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: RGS3 Antibody (1E8-C7) [H00005998-M01] - Detection limit for recombinant GST tagged RGS3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1E8-C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RGS3 Antibody (1E8-C7) Summary

Immunogen
RGS3 (AAH18072, 1 a.a. - 192 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Specificity
RGS3 - regulator of G-protein signalling 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RGS3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGS3 Antibody (1E8-C7)

  • C2PA
  • FLJ20370
  • FLJ31516
  • FLJ90496
  • PDZ-RGS3
  • regulator of G-protein signaling 3
  • regulator of G-protein signalling 3
  • RGP3

Background

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NLS418
Species: Hu
Applications: IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for RGS3 Antibody (H00005998-M01) (0)

There are no publications for RGS3 Antibody (H00005998-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS3 Antibody (H00005998-M01) (0)

There are no reviews for RGS3 Antibody (H00005998-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGS3 Antibody (H00005998-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RGS3 Antibody (H00005998-M01)

Discover related pathways, diseases and genes to RGS3 Antibody (H00005998-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS3 Antibody (H00005998-M01)

Discover more about diseases related to RGS3 Antibody (H00005998-M01).
 

Pathways for RGS3 Antibody (H00005998-M01)

View related products by pathway.

PTMs for RGS3 Antibody (H00005998-M01)

Learn more about PTMs related to RGS3 Antibody (H00005998-M01).
 

Research Areas for RGS3 Antibody (H00005998-M01)

Find related products by research area.

Blogs on RGS3

There are no specific blogs for RGS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS3 Antibody (1E8-C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS3
Entrez
OMIM
Uniprot