RGS18 Antibody

Images

 
Western Blot: RGS18 Antibody [NBP1-92329] - Analysis in control (vector only transfected HEK293T lysate) and RGS18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RGS18 Antibody [NBP1-92329] - Staining of human bone marrow shows strong nuclear positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
Specificity
Specificity of human RGS18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RGS18 Protein (NBP1-92329PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS18 Antibody

  • regulator of G-protein signaling 18
  • regulator of G-protein signalling 13
  • RGS13regulator of G-protein signalling 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005997-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, KD
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00880
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NLS2576
Species: Hu, Rt, Pm
Applications: IHC, IHC-P

Publications for RGS18 Antibody (NBP1-92329) (0)

There are no publications for RGS18 Antibody (NBP1-92329).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS18 Antibody (NBP1-92329) (0)

There are no reviews for RGS18 Antibody (NBP1-92329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS18 Antibody (NBP1-92329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RGS18 Products

Bioinformatics Tool for RGS18 Antibody (NBP1-92329)

Discover related pathways, diseases and genes to RGS18 Antibody (NBP1-92329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS18 Antibody (NBP1-92329)

Discover more about diseases related to RGS18 Antibody (NBP1-92329).
 

Pathways for RGS18 Antibody (NBP1-92329)

View related products by pathway.

PTMs for RGS18 Antibody (NBP1-92329)

Learn more about PTMs related to RGS18 Antibody (NBP1-92329).
 

Research Areas for RGS18 Antibody (NBP1-92329)

Find related products by research area.

Blogs on RGS18

There are no specific blogs for RGS18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS18