RGS18 Antibody - BSA Free

Western Blot: RGS18 Antibody [NBP1-92329] - Analysis in control (vector only transfected HEK293T lysate) and RGS18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: RGS18 Antibody [NBP1-92329] - Staining of human bone marrow shows strong nuclear positivity in megakaryocytes.

Analysis in control (vector only transfected HEK293T lysate) and RGS18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RGS18 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGS18
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RGS18 Protein (NBP1-92329PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RGS18 Antibody - BSA Free

• regulator of G-protein signaling 18
• regulator of G-protein signalling 13
• RGS13regulator of G-protein signalling 18

Background

Regulators of G-protein signaling (RGSs) are a protein family that can act as GTPase-activating proteins for G(alphai)- and G(alphaq)-class proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination. One of these proteins, RGS18, is a 235 amino acid protein that is closely related to RGS5 (46% identity) and approximately 30-40% identity to other RGS proteins. This protein is expressed in platelet, leukocyte, and megakaryocyte cell lines. Engagement of TLR3 or TLR4 on monocyte-derived DCs potently down-regulates RGS18 and RGS14 without modifying other RGS proteins. A similar pattern of RGS protein expression occurs in immature bone marrow-derived mouse DCs stimulated to mature via TLR4 signaling. The changes in RGS18 and RGS1 expression are likely important for DC function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RGS18 Antibody (NBP1-92329)(2)

Publications using NBP1-92329

• Liu X, Song J, Zhang H et al. Immune checkpoint HLA-E:CD94-NKG2A mediates evasion of circulating tumor cells from NK cell surveillance Cancer cell 2023-01-18 [PMID: 36706761] (IHC-P, KD, WB, Human, Mouse)
• Masuho I, Balaji S, Muntean BS et al. A Global Map of G Protein Signaling Regulation by RGS Proteins Cell 2020-09-24 [PMID: 33007266] (WB, Human)

Bioinformatics

• Gene Symbol: RGS18