| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RGS18 Antibody - BSA Free (NBP1-92329) is a polyclonal antibody validated for use in IHC and WB. Anti-RGS18 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RGS18 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-92329 | Applications | Species |
|---|---|---|
| Liu X, Song J, Zhang H et al. Immune checkpoint HLA-E:CD94-NKG2A mediates evasion of circulating tumor cells from NK cell surveillance Cancer cell 2023-01-18 [PMID: 36706761] (IHC-P, KD, WB, Human, Mouse) | IHC-P, KD, WB | Human, Mouse |
| Masuho I, Balaji S, Muntean BS et al. A Global Map of G Protein Signaling Regulation by RGS Proteins Cell 2020-09-24 [PMID: 33007266] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for RGS18 Antibody (NBP1-92329)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RGS18 |