RGS14 Antibody

Images

 
Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human lymph node shows moderate nuclear and cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLE NRITFELELTALERVVRISAKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RGS14 Protein (NBP2-13227PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS14 Antibody

  • regulator of G-protein signaling 14
  • regulator of G-protein signalling 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55755
Species: Hu
Applications: ICC/IF
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56734
Species: Hu
Applications: WB
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP1-31769
Species: Hu, Mu
Applications: WB, ICC/IF
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RGS14 Antibody (NBP2-13227) (0)

There are no publications for RGS14 Antibody (NBP2-13227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS14 Antibody (NBP2-13227) (0)

There are no reviews for RGS14 Antibody (NBP2-13227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGS14 Antibody (NBP2-13227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS14 Products

Bioinformatics Tool for RGS14 Antibody (NBP2-13227)

Discover related pathways, diseases and genes to RGS14 Antibody (NBP2-13227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS14 Antibody (NBP2-13227)

Discover more about diseases related to RGS14 Antibody (NBP2-13227).
 

Pathways for RGS14 Antibody (NBP2-13227)

View related products by pathway.

PTMs for RGS14 Antibody (NBP2-13227)

Learn more about PTMs related to RGS14 Antibody (NBP2-13227).
 

Research Areas for RGS14 Antibody (NBP2-13227)

Find related products by research area.

Blogs on RGS14

There are no specific blogs for RGS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS14