RGS14 Antibody


Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human lymph node shows moderate nuclear and cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining in human lymph node and skeletal muscle tissues using anti-RGS14 antibody. Corresponding RGS14 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RGS14 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLE NRITFELELTALERVVRISAKP
Specificity of human RGS14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RGS14 Protein (NBP2-13227PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RGS14 Antibody

  • regulator of G-protein signaling 14
  • regulator of G-protein signalling 14


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RGS14 Antibody (NBP2-13227) (0)

There are no publications for RGS14 Antibody (NBP2-13227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS14 Antibody (NBP2-13227) (0)

There are no reviews for RGS14 Antibody (NBP2-13227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGS14 Antibody (NBP2-13227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RGS14 Products

Bioinformatics Tool for RGS14 Antibody (NBP2-13227)

Discover related pathways, diseases and genes to RGS14 Antibody (NBP2-13227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS14 Antibody (NBP2-13227)

Discover more about diseases related to RGS14 Antibody (NBP2-13227).

Pathways for RGS14 Antibody (NBP2-13227)

View related products by pathway.

PTMs for RGS14 Antibody (NBP2-13227)

Learn more about PTMs related to RGS14 Antibody (NBP2-13227).

Research Areas for RGS14 Antibody (NBP2-13227)

Find related products by research area.

Blogs on RGS14

There are no specific blogs for RGS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RGS14 Antibody and receive a gift card or discount.


Gene Symbol RGS14