RGS13 Antibody

Images

 
Western Blot: RGS13 Antibody [H00006003-B01P] - Analysis of RGS13 expression in transfected 293T cell line by RGS13 polyclonal antibody. Lane 1: RGS13 transfected lysate(17.49 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: RGS13 Antibody [H00006003-B01P] - Purified MaxPab antibody to RGS13 on HeLa cell. [antibody concentration 10 ug/ml]
Immunohistochemistry-Paraffin: RGS13 Antibody [H00006003-B01P] - Analysis of purified antibody to RGS13 on formalin-fixed paraffin-embedded human esophagus. (antibody concentration 3 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RGS13 Antibody Summary

Immunogen
RGS13 (NP_002918.1, 1 a.a. - 159 a.a.) full-length human protein. MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Specificity
RGS13 - regulator of G-protein signalling 13.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RGS13
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGS13 Antibody

  • MGC17173
  • regulator of G-protein signaling 13
  • regulator of G-protein signalling 13

Background

The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for RGS13 Antibody (H00006003-B01P) (0)

There are no publications for RGS13 Antibody (H00006003-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS13 Antibody (H00006003-B01P) (0)

There are no reviews for RGS13 Antibody (H00006003-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGS13 Antibody (H00006003-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS13 Products

Bioinformatics Tool for RGS13 Antibody (H00006003-B01P)

Discover related pathways, diseases and genes to RGS13 Antibody (H00006003-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS13 Antibody (H00006003-B01P)

Discover more about diseases related to RGS13 Antibody (H00006003-B01P).
 

Pathways for RGS13 Antibody (H00006003-B01P)

View related products by pathway.

PTMs for RGS13 Antibody (H00006003-B01P)

Learn more about PTMs related to RGS13 Antibody (H00006003-B01P).
 

Research Areas for RGS13 Antibody (H00006003-B01P)

Find related products by research area.

Blogs on RGS13

There are no specific blogs for RGS13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS13
Entrez
Uniprot