RGS13 Antibody - Azide and BSA Free

Western Blot: RGS13 Antibody [H00006003-B01P] - Analysis of RGS13 expression in transfected 293T cell line by RGS13 polyclonal antibody. Lane 1: RGS13 transfected lysate(17.49 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: RGS13 Antibody [H00006003-B01P] - Purified MaxPab antibody to RGS13 on HeLa cell. [antibody concentration 10 ug/ml]

Immunohistochemistry-Paraffin: RGS13 Antibody [H00006003-B01P] - Analysis of purified antibody to RGS13 on formalin-fixed paraffin-embedded human esophagus. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RGS13 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RGS13 (NP_002918.1, 1 a.a. - 159 a.a.) full-length human protein. MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
• Specificity: RGS13 - regulator of G-protein signalling 13.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RGS13
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGS13 Antibody - Azide and BSA Free

• MGC17173
• regulator of G-protein signaling 13
• regulator of G-protein signalling 13

Background

The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RGS13
• Entrez:
  • 6003(Human)
• Uniprot:
  • NP_002918.1(Human)