RGC32 Antibody (3B9)

Images

 
Immunocytochemistry/ Immunofluorescence: RGC32 Antibody (3B9) [H00028984-M01] - Analysis of monoclonal antibody to C13orf15 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RGC32 Antibody (3B9) [H00028984-M01] - Detection limit for recombinant GST tagged C13orf15 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, S-ELISA
Clone
3B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RGC32 Antibody (3B9) Summary

Immunogen
C13orf15 (NP_054778.1, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Specificity
Reacts with chromosome 13 open reading frame 15.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RGCC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGC32 Antibody (3B9)

  • bA157L14.2
  • chromosome 13 open reading frame 15
  • KIAA0564
  • RGC-32MGC87338
  • RGC32response gene to complement 32 protein

Background

This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
AF1555
Species: Hu
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RGC32 Antibody (H00028984-M01) (0)

There are no publications for RGC32 Antibody (H00028984-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGC32 Antibody (H00028984-M01) (0)

There are no reviews for RGC32 Antibody (H00028984-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGC32 Antibody (H00028984-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RGC32 Products

Bioinformatics Tool for RGC32 Antibody (H00028984-M01)

Discover related pathways, diseases and genes to RGC32 Antibody (H00028984-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RGC32 Antibody (H00028984-M01)

Find related products by research area.

Blogs on RGC32

There are no specific blogs for RGC32, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGC32 Antibody (3B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol RGCC
Entrez
Uniprot