RFXAP Recombinant Protein Antigen

Images

 
There are currently no images for RFXAP Recombinant Protein Antigen (NBP2-58217PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RFXAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFXAP.

Source: E. coli

Amino Acid Sequence: NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RFXAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58217.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RFXAP Recombinant Protein Antigen

  • regulatory factor X-associated protein
  • RFX DNA-binding complex 36 kDa subunit
  • RFX-associated protein

Background

The identification of transacting factors controlling major histocompatibility complex (MHC) class II gene transcription via the proximal enhancer of the promoter has been greatly facilitated by a genetic approach, namely, the analysis of cell lines that are characterized by regulatory defects abolishing transcription of these genes (Mach et al., 1996). Most of these MHC class II regulatory mutants are cell lines derived from patients suffering from MHC class II deficiency, also referred to as the bare lymphocyte syndrome type II, a rare autosomal recessive disorder characterized by the lack of constitutive and inducible MHC class II expression in all cell types and tissues. The genetic lesions responsible for this lack of expression lie not in MHC class II genes themselves, but in transacting regulatory genes required for their transcription (Mach et al., 1996). Durand et al. (1997) noted that at least 3 different complementation groups (groups A, B, and C) have been identified by means of somatic cell fusion experiments. the defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC class II promoters Durand et al. (1997) isolated a novel gene that encodes the 36-kD subunit of RFX. They called this subunit RFX-associated protein (RFXAP) because it is a subunit of the RFX complex and interacts with RFX5, yet it does not contain the characteristic RFX DNA-binding motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01756
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86041
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-52654
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-59072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-71805
Species: Hu
Applications: IP, WB
NBP2-47525
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19535
Species: Hu, Mu, Rt, Ze
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
H00004802-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38747
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-06185
Species: Hu
Applications: ICC/IF,  IHC-P
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00057763-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)

There are no publications for RFXAP Recombinant Protein Antigen (NBP2-58217PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)

There are no reviews for RFXAP Recombinant Protein Antigen (NBP2-58217PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFXAP Products

Array NBP2-58217PEP

Research Areas for RFXAP Recombinant Protein Antigen (NBP2-58217PEP)

Find related products by research area.

Blogs on RFXAP

There are no specific blogs for RFXAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RFXAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RFXAP