RFXAP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFXAP. Source: E. coli Amino Acid Sequence: NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RFXAP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58217. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for RFXAP Recombinant Protein Antigen
Background
The identification of transacting factors controlling major histocompatibility complex (MHC) class II gene transcription via the proximal enhancer of the promoter has been greatly facilitated by a genetic approach, namely, the analysis of cell lines that are characterized by regulatory defects abolishing transcription of these genes (Mach et al., 1996). Most of these MHC class II regulatory mutants are cell lines derived from patients suffering from MHC class II deficiency, also referred to as the bare lymphocyte syndrome type II, a rare autosomal recessive disorder characterized by the lack of constitutive and inducible MHC class II expression in all cell types and tissues. The genetic lesions responsible for this lack of expression lie not in MHC class II genes themselves, but in transacting regulatory genes required for their transcription (Mach et al., 1996). Durand et al. (1997) noted that at least 3 different complementation groups (groups A, B, and C) have been identified by means of somatic cell fusion experiments. the defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC class II promoters Durand et al. (1997) isolated a novel gene that encodes the 36-kD subunit of RFX. They called this subunit RFX-associated protein (RFXAP) because it is a subunit of the RFX complex and interacts with RFX5, yet it does not contain the characteristic RFX DNA-binding motif.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Publications for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)
There are no publications for RFXAP Recombinant Protein Antigen (NBP2-58217PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)
There are no reviews for RFXAP Recombinant Protein Antigen (NBP2-58217PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RFXAP Recombinant Protein Antigen (NBP2-58217PEP) (0)
Additional RFXAP Products
Research Areas for RFXAP Recombinant Protein Antigen (NBP2-58217PEP)
Find related products by research area.
|
Blogs on RFXAP