RFX2 Recombinant Protein Antigen

Images

 
There are currently no images for RFX2 Protein (NBP2-13224PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RFX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFX2.

Source: E. coli

Amino Acid Sequence: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RFX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13224.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RFX2 Recombinant Protein Antigen

  • DNA binding protein RFX2
  • DNA-binding protein RFX2
  • FLJ14226
  • HLA class II regulatory factor RFX2
  • Regulatory factor X 2
  • regulatory factor X, 2 (influences HLA class II expression)
  • trans-acting regulatory factor 2

Background

RFX2 is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52654
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-86301
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-48967
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-19461
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
M5000
Species: Mu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
NB100-2475
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF3619
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-90171
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-27188
Species: Ca, Hu, Po, Pm
Applications: Simple Western, WB
NBP2-13744
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3025
Species: Hu
Applications: ELISA, ICC, WB
AF746
Species: Hu, Mu
Applications: WB
NBP2-49342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13224PEP
Species: Hu
Applications: AC

Publications for RFX2 Protein (NBP2-13224PEP) (0)

There are no publications for RFX2 Protein (NBP2-13224PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFX2 Protein (NBP2-13224PEP) (0)

There are no reviews for RFX2 Protein (NBP2-13224PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RFX2 Protein (NBP2-13224PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFX2 Products

Blogs on RFX2

There are no specific blogs for RFX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RFX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RFX2