Recombinant Human RFPL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RFPL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 189-278 of Human RFPL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RFPL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFPL1 Protein

  • MGC132428
  • ret finger protein-like 1
  • RFPL1L
  • RNF78RING finger protein 78

Background

RFPL1 - ret finger protein-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38425
Species: Hu
Applications: IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02034
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57626
Species: Hu
Applications: ICC/IF
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-77120
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for RFPL1 Partial Recombinant Protein (H00005988-Q01) (0)

There are no publications for RFPL1 Partial Recombinant Protein (H00005988-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFPL1 Partial Recombinant Protein (H00005988-Q01) (0)

There are no reviews for RFPL1 Partial Recombinant Protein (H00005988-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFPL1 Partial Recombinant Protein (H00005988-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFPL1 Products

Bioinformatics Tool for RFPL1 Partial Recombinant Protein (H00005988-Q01)

Discover related pathways, diseases and genes to RFPL1 Partial Recombinant Protein (H00005988-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFPL1 Partial Recombinant Protein (H00005988-Q01)

Discover more about diseases related to RFPL1 Partial Recombinant Protein (H00005988-Q01).
 

Pathways for RFPL1 Partial Recombinant Protein (H00005988-Q01)

View related products by pathway.

Research Areas for RFPL1 Partial Recombinant Protein (H00005988-Q01)

Find related products by research area.

Blogs on RFPL1

There are no specific blogs for RFPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Pax6 Antibody
NB300-750

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFPL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFPL1