Recombinant Human Rev-erb beta/NR1D2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Rev-erb beta/NR1D2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-579 of Human NR1D2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NR1D2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rev-erb beta/NR1D2 Protein

  • BD73
  • EAR-1R
  • HZF2
  • NR1D2
  • nuclear receptor subfamily 1 group D member 2
  • nuclear receptor subfamily 1, group D, member 2
  • Orphan nuclear hormone receptor BD73
  • Reverb beta
  • Rev-erb beta
  • rev-erba-alpha-related receptor
  • rev-erb-beta
  • RVR
  • V-erbA-related protein 1-related

Background

NR1D2( AAH45613, 1 a.a. - 580 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01) (0)

There are no publications for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01) (0)

There are no reviews for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01). (Showing 1 - 2 of 2 FAQ).

  1. Can these proteins be cleaved of their GST tag? If so how? Thrombin? GST tag Removal using GE Healthcare's PreScission Protease?
    • The GST tag can be cleaved using our protocol which is available on our website under the Support area. This protocol uses GE Healthcare's Prescission protease.
  2. Are there any post-translational modifications?
    • Both H00009572-P01 and H00009975-P01 are produced using the in vitro wheat germ expression system which allows for expression of mammalian proteins with proper glycosylation and native post-translational modifications (PTM).

Additional Rev-erb beta/NR1D2 Products

Bioinformatics Tool for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01)

Discover related pathways, diseases and genes to Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01)

Discover more about diseases related to Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01).
 

Pathways for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01)

View related products by pathway.

PTMs for Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01)

Learn more about PTMs related to Rev-erb beta/NR1D2 Recombinant Protein (H00009975-P01).

Blogs on Rev-erb beta/NR1D2

There are no specific blogs for Rev-erb beta/NR1D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rev-erb beta/NR1D2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1D2
Entrez