Recombinant Human retinol dehydrogenase 8 (all trans) GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human retinol dehydrogenase 8 (all trans) GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-311 of Human RDH8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RDH8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
61.16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human retinol dehydrogenase 8 (all trans) GST (N-Term) Protein

  • photoreceptor outer segment all-trans retinol dehydrogenase
  • PRRDH
  • retinol dehydrogenase 8 (all-trans)
  • retinol dehydrogenase 8
  • SDR28C2
  • short chain dehydrogenase/reductase family 28C, member 2

Background

All-trans-retinol dehydrogenase (RDH8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH (Rattner et al., 2000 [PubMed 10753906]). It is a member of the short chain dehydrogenase/reductase family and is located in the outer segments of photoreceptors; hence it is also known as photoreceptor retinol dehydrogenase. It is important in the visual cycle by beginning the rhodopsin regeneration pathway by reducing all-trans-retinal, the product of bleached and hydrolysed rhodopsin (Rando, 2001 [PubMed 11710234]). This is a rate-limiting step in the visual cycle (Saari et al., 1998 [PubMed 9667000]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
664-LI
Species: Hu
Applications: BA
NBP1-90232
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-32431
Species: Hu
Applications: IHC, IHC-P
NBP1-56853
Species: Hu
Applications: IHC, IHC-P, WB
H00145226-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-52047
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
NB100-74392
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
640-A3
Species: Mu
Applications: Bind
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-87094
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4019
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-02431
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93946
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01) (0)

There are no publications for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01) (0)

There are no reviews for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional retinol dehydrogenase 8 (all trans) Products

Bioinformatics Tool for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01)

Discover related pathways, diseases and genes to retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01)

Discover more about diseases related to retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01).
 

Pathways for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01)

View related products by pathway.

PTMs for retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01)

Learn more about PTMs related to retinol dehydrogenase 8 (all trans) Recombinant Protein (H00050700-P01).

Blogs on retinol dehydrogenase 8 (all trans)

There are no specific blogs for retinol dehydrogenase 8 (all trans), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human retinol dehydrogenase 8 (all trans) GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RDH8