Recombinant Human REPIN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human REPIN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human REPIN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPECGRRFRHAPFLALHRQVHAAA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
REPIN1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REPIN1 Protein

  • 60 kDa origin-specific DNA-binding protein
  • 60 kDa replication initiation region protein
  • ATT-binding protein
  • DHFR oribeta-binding protein RIP60
  • H_DJ0584D14.12
  • replication initiation region protein (60kD)
  • replication initiator 1
  • RIP60AP4
  • Zfp464
  • zinc finger protein 464 (RIP60)
  • Zinc finger protein 464
  • zinc finger protein AP4
  • zinc finger proten AP4
  • ZNF464

Background

REPIN1 - replication initiator 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP

Publications for REPIN1 Partial Recombinant Protein (H00029803-Q01) (0)

There are no publications for REPIN1 Partial Recombinant Protein (H00029803-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REPIN1 Partial Recombinant Protein (H00029803-Q01) (0)

There are no reviews for REPIN1 Partial Recombinant Protein (H00029803-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REPIN1 Partial Recombinant Protein (H00029803-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REPIN1 Products

Bioinformatics Tool for REPIN1 Partial Recombinant Protein (H00029803-Q01)

Discover related pathways, diseases and genes to REPIN1 Partial Recombinant Protein (H00029803-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REPIN1 Partial Recombinant Protein (H00029803-Q01)

Discover more about diseases related to REPIN1 Partial Recombinant Protein (H00029803-Q01).
 

Pathways for REPIN1 Partial Recombinant Protein (H00029803-Q01)

View related products by pathway.

PTMs for REPIN1 Partial Recombinant Protein (H00029803-Q01)

Learn more about PTMs related to REPIN1 Partial Recombinant Protein (H00029803-Q01).

Blogs on REPIN1

There are no specific blogs for REPIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
REPIN1 Antibody
NBP1-89059

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human REPIN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REPIN1