RENT1/UPF1/hUPF1 Antibody

Images

 
Immunohistochemistry: RENT1/UPF1/hUPF1 Antibody [NBP1-89642] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RENT1/UPF1/hUPF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RENT1/UPF1/hUPF1 Protein (NBP1-89642PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RENT1/UPF1/hUPF1 Antibody

  • ATP-dependent helicase RENT1
  • EC 3.6.1
  • EC 3.6.4.-
  • FLJ43809
  • HUPF1
  • KIAA0221FLJ46894
  • Nonsense mRNA reducing factor 1
  • NORF1
  • NORF1delta helicase
  • pNORF1
  • regulator of nonsense transcripts 1
  • RENT1
  • RENT1UP Frameshift 1
  • UPF1 regulator of nonsense transcripts homolog (yeast)
  • UPF1
  • up-frameshift mutation 1 homolog
  • Up-frameshift suppressor 1 homolog
  • yeast Upf1p homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-57560
Species: Hu
Applications: ICC/IF
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92410
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69312
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33202
Species: Hu, Mu
Applications: WB, IP
NBP2-38045
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13279
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88486
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89642
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for RENT1/UPF1/hUPF1 Antibody (NBP1-89642) (0)

There are no publications for RENT1/UPF1/hUPF1 Antibody (NBP1-89642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RENT1/UPF1/hUPF1 Antibody (NBP1-89642) (0)

There are no reviews for RENT1/UPF1/hUPF1 Antibody (NBP1-89642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RENT1/UPF1/hUPF1 Antibody (NBP1-89642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RENT1/UPF1/hUPF1 Products

Bioinformatics Tool for RENT1/UPF1/hUPF1 Antibody (NBP1-89642)

Discover related pathways, diseases and genes to RENT1/UPF1/hUPF1 Antibody (NBP1-89642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RENT1/UPF1/hUPF1 Antibody (NBP1-89642)

Discover more about diseases related to RENT1/UPF1/hUPF1 Antibody (NBP1-89642).
 

Pathways for RENT1/UPF1/hUPF1 Antibody (NBP1-89642)

View related products by pathway.

PTMs for RENT1/UPF1/hUPF1 Antibody (NBP1-89642)

Learn more about PTMs related to RENT1/UPF1/hUPF1 Antibody (NBP1-89642).
 

Research Areas for RENT1/UPF1/hUPF1 Antibody (NBP1-89642)

Find related products by research area.

Blogs on RENT1/UPF1/hUPF1

There are no specific blogs for RENT1/UPF1/hUPF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RENT1/UPF1/hUPF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF1
Entrez