RENT1/UPF1/hUPF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UPF1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RENT1/UPF1/hUPF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UPF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RENT1/UPF1/hUPF1 Protein (NBP1-89641PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RENT1/UPF1/hUPF1 Antibody - BSA Free

• ATP-dependent helicase RENT1
• EC 3.6.1
• EC 3.6.4.-
• FLJ43809
• HUPF1
• KIAA0221FLJ46894
• Nonsense mRNA reducing factor 1
• NORF1
• NORF1delta helicase
• pNORF1
• regulator of nonsense transcripts 1
• RENT1
• RENT1UP Frameshift 1
• UPF1 regulator of nonsense transcripts homolog (yeast)
• UPF1
• up-frameshift mutation 1 homolog
• Up-frameshift suppressor 1 homolog
• yeast Upf1p homolog

Background

hUPF1 encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RENT1/UPF1/hUPF1 Antibody (NBP1-89641)(1)

Publication using NBP1-89641

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (WB, Human)

Bioinformatics

• Gene Symbol: UPF1