RECQ1 Antibody (4D5)

Images

 
Sandwich ELISA: RECQ1 Antibody (4D5) [H00005965-M07] - Detection limit for recombinant GST tagged RECQL is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RECQ1 Antibody (4D5) Summary

Immunogen
RECQL (NP_116559.1 549 a.a. - 648 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD
Specificity
RECQL - RecQ protein-like (DNA helicase Q1-like) (4D5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RECQL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RECQ1 Antibody (4D5)

  • DNA helicase, RecQ-like type 1
  • DNA-dependent ATPase Q1
  • EC 3.6.1
  • EC 3.6.4.12
  • RecQ protein-like (DNA helicase Q1-like)
  • RecQ protein-like 1
  • RECQ1
  • RecQ1ATP-dependent DNA helicase Q1
  • RecQL1

Background

The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. Some members of this family are associated with genetic disorders with predisposition to malignancy and chromosomal instability. The biological function of this helicase has not yet been determined. Two alternatively spliced transcripts, which encode the same isoform but differ in their 5' and 3' UTRs, have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33169
Species: Hu, Mu
Applications: WB
NBP2-16338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
H00007156-R01
Species: Hu
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB110-13364
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005965-M07
Species: Hu
Applications: WB, ELISA

Publications for RECQ1 Antibody (H00005965-M07) (0)

There are no publications for RECQ1 Antibody (H00005965-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RECQ1 Antibody (H00005965-M07) (0)

There are no reviews for RECQ1 Antibody (H00005965-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RECQ1 Antibody (H00005965-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RECQ1 Products

Bioinformatics Tool for RECQ1 Antibody (H00005965-M07)

Discover related pathways, diseases and genes to RECQ1 Antibody (H00005965-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECQ1 Antibody (H00005965-M07)

Discover more about diseases related to RECQ1 Antibody (H00005965-M07).
 

Pathways for RECQ1 Antibody (H00005965-M07)

View related products by pathway.

PTMs for RECQ1 Antibody (H00005965-M07)

Learn more about PTMs related to RECQ1 Antibody (H00005965-M07).
 

Research Areas for RECQ1 Antibody (H00005965-M07)

Find related products by research area.

Blogs on RECQ1

There are no specific blogs for RECQ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RECQ1 Antibody (4D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RECQL
Entrez
Uniprot