Recombinant Human REC8 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human REC8 Protein [H00009985-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human REC8 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human REC8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
REC8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REC8 GST (N-Term) Protein

  • Cohesin Rec8p
  • cohesion rec8p
  • HR21spB
  • meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family
  • meiotic recombination protein REC8 homolog
  • meiotic recombination protein REC8-like 1
  • MGC950
  • REC8 homolog (yeast)
  • REC8L1human homolog of rad21, S. pombe
  • REC8-like 1 (yeast)
  • REC8-like 1
  • Rec8p
  • recombination and sister chromatid cohesion protein homolog

Background

This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20053
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-47258
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87904
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for REC8 Partial Recombinant Protein (H00009985-Q01) (0)

There are no publications for REC8 Partial Recombinant Protein (H00009985-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REC8 Partial Recombinant Protein (H00009985-Q01) (0)

There are no reviews for REC8 Partial Recombinant Protein (H00009985-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REC8 Partial Recombinant Protein (H00009985-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REC8 Products

Bioinformatics Tool for REC8 Partial Recombinant Protein (H00009985-Q01)

Discover related pathways, diseases and genes to REC8 Partial Recombinant Protein (H00009985-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REC8 Partial Recombinant Protein (H00009985-Q01)

Discover more about diseases related to REC8 Partial Recombinant Protein (H00009985-Q01).
 

Pathways for REC8 Partial Recombinant Protein (H00009985-Q01)

View related products by pathway.

PTMs for REC8 Partial Recombinant Protein (H00009985-Q01)

Learn more about PTMs related to REC8 Partial Recombinant Protein (H00009985-Q01).
 

Research Areas for REC8 Partial Recombinant Protein (H00009985-Q01)

Find related products by research area.

Blogs on REC8

There are no specific blogs for REC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human REC8 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REC8