REC8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skin shows very weak positivity in squamous epthelial cells.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human liver shows negative no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
REC8 Protein (NBP1-87145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REC8 Antibody

  • Cohesin Rec8p
  • cohesion rec8p
  • HR21spB
  • meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family
  • meiotic recombination protein REC8 homolog
  • meiotic recombination protein REC8-like 1
  • MGC950
  • REC8 homolog (yeast)
  • REC8L1human homolog of rad21, S. pombe
  • REC8-like 1 (yeast)
  • REC8-like 1
  • Rec8p
  • recombination and sister chromatid cohesion protein homolog

Background

REC8 encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-47258
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-20287
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87904
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for REC8 Antibody (NBP1-87145) (0)

There are no publications for REC8 Antibody (NBP1-87145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REC8 Antibody (NBP1-87145) (0)

There are no reviews for REC8 Antibody (NBP1-87145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for REC8 Antibody (NBP1-87145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REC8 Products

Bioinformatics Tool for REC8 Antibody (NBP1-87145)

Discover related pathways, diseases and genes to REC8 Antibody (NBP1-87145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REC8 Antibody (NBP1-87145)

Discover more about diseases related to REC8 Antibody (NBP1-87145).
 

Pathways for REC8 Antibody (NBP1-87145)

View related products by pathway.

PTMs for REC8 Antibody (NBP1-87145)

Learn more about PTMs related to REC8 Antibody (NBP1-87145).
 

Research Areas for REC8 Antibody (NBP1-87145)

Find related products by research area.

Blogs on REC8

There are no specific blogs for REC8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REC8