REC8 Antibody


Western Blot: REC8 Antibody [NBP1-87145] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-469
Immunocytochemistry/ Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

REC8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI
Specificity of human REC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
REC8 Protein (NBP1-87145PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for REC8 Antibody

  • Cohesin Rec8p
  • cohesion rec8p
  • HR21spB
  • meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family
  • meiotic recombination protein REC8 homolog
  • meiotic recombination protein REC8-like 1
  • MGC950
  • REC8 homolog (yeast)
  • REC8L1human homolog of rad21, S. pombe
  • REC8-like 1 (yeast)
  • REC8-like 1
  • Rec8p
  • recombination and sister chromatid cohesion protein homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for REC8 Antibody (NBP1-87145) (0)

There are no publications for REC8 Antibody (NBP1-87145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REC8 Antibody (NBP1-87145) (0)

There are no reviews for REC8 Antibody (NBP1-87145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for REC8 Antibody (NBP1-87145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional REC8 Products

Bioinformatics Tool for REC8 Antibody (NBP1-87145)

Discover related pathways, diseases and genes to REC8 Antibody (NBP1-87145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REC8 Antibody (NBP1-87145)

Discover more about diseases related to REC8 Antibody (NBP1-87145).

Pathways for REC8 Antibody (NBP1-87145)

View related products by pathway.

PTMs for REC8 Antibody (NBP1-87145)

Learn more about PTMs related to REC8 Antibody (NBP1-87145).

Research Areas for REC8 Antibody (NBP1-87145)

Find related products by research area.

Blogs on REC8

There are no specific blogs for REC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our REC8 Antibody and receive a gift card or discount.


Gene Symbol REC8