RDH13 Antibody - BSA Free

Western Blot: RDH13 Antibody [NBP2-85618] - WB Suggested Anti-RDH13 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RDH13 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of RDH13. Peptide sequence: PSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RDH13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RDH13 Antibody - BSA Free

• DKFZp313H0740
• EC 1.1.1.-
• FLJ39479
• retinol dehydrogenase 13 (all-trans and 9-cis)
• retinol dehydrogenase 13 (all-trans/9-cis)
• retinol dehydrogenase 13
• SDR7C3
• short chain dehydrogenase/reductase family 7C, member 3

Background

The RDH13 gene encodes a mitochondrial short-chain dehydrogenase/reductase, which catalyzes the reduction and oxidation ofretinoids. The encoded enzyme may function in retinoic acid production and may also protect the mitochondria againstoxidative stress. Alte

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RDH13