RCC1 Antibody

Images

 
Western Blot: RCC1 Antibody [H00001104-D01P] - Analysis of RCC1 expression in transfected 293T cell line by RCC1 polyclonal antibody.Lane 1: RCC1 transfected lysate(45.00 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: RCC1 Antibody [H00001104-D01P] - Analysis of antibody to RCC1 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCC1 Antibody Summary

Immunogen
RCC1 (NP_001260.1, 1 a.a. - 421 a.a.) full-length human protein. MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Specificity
RCC1 - regulator of chromosome condensation 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCC1 Antibody

  • Cell cycle regulatory protein
  • CHC1RCC1-I
  • chromosome condensation 1
  • Chromosome condensation protein 1
  • guanine nucleotide-releasing protein
  • regulator of chromosome condensation 1
  • regulator of chromosome condensation
  • SNHG3-RCC1 readthrough transcript
  • SNHG3-RCC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF6260
Species: Hu
Applications: WB
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for RCC1 Antibody (H00001104-D01P) (0)

There are no publications for RCC1 Antibody (H00001104-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCC1 Antibody (H00001104-D01P) (0)

There are no reviews for RCC1 Antibody (H00001104-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCC1 Antibody (H00001104-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCC1 Products

Bioinformatics Tool for RCC1 Antibody (H00001104-D01P)

Discover related pathways, diseases and genes to RCC1 Antibody (H00001104-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCC1 Antibody (H00001104-D01P)

Discover more about diseases related to RCC1 Antibody (H00001104-D01P).
 

Pathways for RCC1 Antibody (H00001104-D01P)

View related products by pathway.

PTMs for RCC1 Antibody (H00001104-D01P)

Learn more about PTMs related to RCC1 Antibody (H00001104-D01P).
 

Research Areas for RCC1 Antibody (H00001104-D01P)

Find related products by research area.

Blogs on RCC1.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm.  Transportin 1 is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCC1
Entrez
Uniprot