RBX1 Recombinant Protein Antigen

Images

 
There are currently no images for RBX1 Recombinant Protein Antigen (NBP1-88742PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBX1.

Source: E. coli

Amino Acid Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88742.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBX1 Recombinant Protein Antigen

  • BA554C12.1
  • EC 6.3.2.-
  • FLJ60363
  • MGC13357
  • Protein ZYP
  • RBX1
  • Regulator of cullins 1
  • Ring Box 1
  • RING box protein 1
  • RING finger protein 75
  • ring-box 1
  • ring-box 1, E3 ubiquitin protein ligase
  • RING-box protein 1
  • RNF75
  • RNF75MGC1481
  • ROC1E3 ubiquitin-protein ligase RBX1
  • ZYP Protein

Background

ROC1 is a component of the SCF (SKP1-CUL1-F-box protein) and the CBC(VHL) (CUL2-elonging BC-VHL) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. ROC1 appears to recruit the E2 ubiquitination enzyme through the RING-type zinc finger in a manner similar to CDC34, and brings it into close proximity to the substrate. The RING-type zinc finger domain is essential for ubiquitin ligase activity. ROC1 probably also stimulates CDC34 autoubiquitination and promotes the neddylation of CUL1 and probably CUL2. ROC1 has a cytoplasmic and nuclear localization and is widely expressed in most tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
255-SC
Species: Hu
Applications: BA
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-85594
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
UL-812
Species: Hu, Mu, Rt
Applications: EnzAct
NBP1-49873
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00055294-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-58788
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-25502
Species: Ca, Hu, Mu, Rt, Ze
Applications: IHC,  IHC-P, WB
NBP2-75465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88742PEP
Species: Hu
Applications: AC

Publications for RBX1 Recombinant Protein Antigen (NBP1-88742PEP) (0)

There are no publications for RBX1 Recombinant Protein Antigen (NBP1-88742PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBX1 Recombinant Protein Antigen (NBP1-88742PEP) (0)

There are no reviews for RBX1 Recombinant Protein Antigen (NBP1-88742PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBX1 Recombinant Protein Antigen (NBP1-88742PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBX1 Products

Research Areas for RBX1 Recombinant Protein Antigen (NBP1-88742PEP)

Find related products by research area.

Blogs on RBX1

There are no specific blogs for RBX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBX1