RBPMS2 Antibody

Images

 
Western Blot: RBPMS2 Antibody [NBP2-84238] - WB Suggested Anti-RBPMS2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity Hu, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBPMS2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2. Peptide sequence: ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rabbit (93%), Zebrafish (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
RBPMS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBPMS2 Antibody

  • RNA binding protein with multiple splicing 2
  • RNA-binding protein with multiple splicing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20112
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-21803
Species: Hu, Rt, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA, ELISA(Cap)
AF3757
Species: Hu
Applications: WB, ICC
AF4265
Species: Hu, Mu, Rt
Applications: WB
NBP1-83957
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83664
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-75622
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-84238
Species: Hu, Rb, Ze
Applications: WB

Publications for RBPMS2 Antibody (NBP2-84238) (0)

There are no publications for RBPMS2 Antibody (NBP2-84238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBPMS2 Antibody (NBP2-84238) (0)

There are no reviews for RBPMS2 Antibody (NBP2-84238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBPMS2 Antibody (NBP2-84238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RBPMS2 Products

Array NBP2-84238

Bioinformatics Tool for RBPMS2 Antibody (NBP2-84238)

Discover related pathways, diseases and genes to RBPMS2 Antibody (NBP2-84238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBPMS2 Antibody (NBP2-84238)

Discover more about diseases related to RBPMS2 Antibody (NBP2-84238).
 

Pathways for RBPMS2 Antibody (NBP2-84238)

View related products by pathway.

Blogs on RBPMS2

There are no specific blogs for RBPMS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBPMS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBPMS2